PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00022729-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family LBD
Protein Properties Length: 219aa    MW: 24121.2 Da    PI: 5.9854
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00022729-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.16.5e-43451441100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca+ Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++gvi +lq+q+++l+
  WALNUT_00022729-RA  45 PCAACKILRRRCAERCVLAPYFPPTEPAKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEASARIRDPVYGCAGVICQLQKQVSELQ 135
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         a+la++++e
  WALNUT_00022729-RA 136 AQLAKAQAE 144
                         ****99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.27544145IPR004883Lateral organ boundaries, LOB
PfamPF031954.4E-4345142IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MECSDMNTIM TTPSSTLQLS RSSSSSSSPP SSPSPTPTPP VVVSPCAACK ILRRRCAERC  60
VLAPYFPPTE PAKFTIAHRV FGASNIIKFL QELPESQRAD AVSSMVYEAS ARIRDPVYGC  120
AGVICQLQKQ VSELQAQLAK AQAEVVNLQC QQANLLALIC MDVSQTPHQA SPHDQHDQQQ  180
YSHENFISTS PDQRYQSNAS LSFLDDYNNL GLMWDPLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007205910.15e-94hypothetical protein PRUPE_ppa011528mg
SwissprotQ9LQR08e-79LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM5W0705e-94M5W070_PRUPE; Uncharacterized protein
STRINGGLYMA11G15810.11e-88(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-61LOB domain-containing protein 1